Anti PRR7 pAb (ATL-HPA046636)

Atlas Antibodies

Catalog No.:
ATL-HPA046636-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: proline rich 7 (synaptic)
Gene Name: PRR7
Alternative Gene Name: MGC10772
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034686: 98%, ENSRNOG00000021447: 98%
Entrez Gene ID: 80758
Uniprot ID: Q8TB68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAPPCPALCLQADRGRRVFPSWTDSELSSREPLEHGAWRLPVSIP
Gene Sequence MSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAPPCPALCLQADRGRRVFPSWTDSELSSREPLEHGAWRLPVSIP
Gene ID - Mouse ENSMUSG00000034686
Gene ID - Rat ENSRNOG00000021447
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRR7 pAb (ATL-HPA046636)
Datasheet Anti PRR7 pAb (ATL-HPA046636) Datasheet (External Link)
Vendor Page Anti PRR7 pAb (ATL-HPA046636) at Atlas Antibodies

Documents & Links for Anti PRR7 pAb (ATL-HPA046636)
Datasheet Anti PRR7 pAb (ATL-HPA046636) Datasheet (External Link)
Vendor Page Anti PRR7 pAb (ATL-HPA046636)