Anti PRR5 pAb (ATL-HPA054072)

Atlas Antibodies

Catalog No.:
ATL-HPA054072-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: proline rich 5 (renal)
Gene Name: PRR5
Alternative Gene Name: FLJ20185k, PP610, Protor-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036106: 83%, ENSRNOG00000012475: 83%
Entrez Gene ID: 55615
Uniprot ID: P85299
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKNPVVRSKSYNTPLLNPVQEHEAEGAAAGGTSIRRHSVSEMTSCPEPQGFSDPPGQGPTGTFRSSPAPHSGPCPSRLYPTTQPPEQGLDPTR
Gene Sequence AKNPVVRSKSYNTPLLNPVQEHEAEGAAAGGTSIRRHSVSEMTSCPEPQGFSDPPGQGPTGTFRSSPAPHSGPCPSRLYPTTQPPEQGLDPTR
Gene ID - Mouse ENSMUSG00000036106
Gene ID - Rat ENSRNOG00000012475
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRR5 pAb (ATL-HPA054072)
Datasheet Anti PRR5 pAb (ATL-HPA054072) Datasheet (External Link)
Vendor Page Anti PRR5 pAb (ATL-HPA054072) at Atlas Antibodies

Documents & Links for Anti PRR5 pAb (ATL-HPA054072)
Datasheet Anti PRR5 pAb (ATL-HPA054072) Datasheet (External Link)
Vendor Page Anti PRR5 pAb (ATL-HPA054072)