Anti PRR35 pAb (ATL-HPA069297)

Atlas Antibodies

Catalog No.:
ATL-HPA069297-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: proline rich 35
Gene Name: PRR35
Alternative Gene Name: C16orf11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025727: 80%, ENSRNOG00000020212: 80%
Entrez Gene ID: 146325
Uniprot ID: P0CG20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EHVGEDLTRALGDYARVEQRLGQLGPAGGLAPRPLREQLGKIRLELLTIHQALEQAVRPPDAPLDLSVKRA
Gene Sequence EHVGEDLTRALGDYARVEQRLGQLGPAGGLAPRPLREQLGKIRLELLTIHQALEQAVRPPDAPLDLSVKRA
Gene ID - Mouse ENSMUSG00000025727
Gene ID - Rat ENSRNOG00000020212
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRR35 pAb (ATL-HPA069297)
Datasheet Anti PRR35 pAb (ATL-HPA069297) Datasheet (External Link)
Vendor Page Anti PRR35 pAb (ATL-HPA069297) at Atlas Antibodies

Documents & Links for Anti PRR35 pAb (ATL-HPA069297)
Datasheet Anti PRR35 pAb (ATL-HPA069297) Datasheet (External Link)
Vendor Page Anti PRR35 pAb (ATL-HPA069297)