Anti PRR35 pAb (ATL-HPA069297)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069297-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PRR35
Alternative Gene Name: C16orf11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025727: 80%, ENSRNOG00000020212: 80%
Entrez Gene ID: 146325
Uniprot ID: P0CG20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EHVGEDLTRALGDYARVEQRLGQLGPAGGLAPRPLREQLGKIRLELLTIHQALEQAVRPPDAPLDLSVKRA |
| Gene Sequence | EHVGEDLTRALGDYARVEQRLGQLGPAGGLAPRPLREQLGKIRLELLTIHQALEQAVRPPDAPLDLSVKRA |
| Gene ID - Mouse | ENSMUSG00000025727 |
| Gene ID - Rat | ENSRNOG00000020212 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRR35 pAb (ATL-HPA069297) | |
| Datasheet | Anti PRR35 pAb (ATL-HPA069297) Datasheet (External Link) |
| Vendor Page | Anti PRR35 pAb (ATL-HPA069297) at Atlas Antibodies |
| Documents & Links for Anti PRR35 pAb (ATL-HPA069297) | |
| Datasheet | Anti PRR35 pAb (ATL-HPA069297) Datasheet (External Link) |
| Vendor Page | Anti PRR35 pAb (ATL-HPA069297) |