Anti PRR32 pAb (ATL-HPA048386)

Atlas Antibodies

Catalog No.:
ATL-HPA048386-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: proline rich 32
Gene Name: PRR32
Alternative Gene Name: CXorf64
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037086: 48%, ENSRNOG00000049388: 46%
Entrez Gene ID: 100130613
Uniprot ID: B1ATL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCIPLHSLRAHRHPYGPPPAVAEESLATAEVNSSDALAGWRQEGQDAINVSWEVSGGPPALIVGGTKVNNG
Gene Sequence SCIPLHSLRAHRHPYGPPPAVAEESLATAEVNSSDALAGWRQEGQDAINVSWEVSGGPPALIVGGTKVNNG
Gene ID - Mouse ENSMUSG00000037086
Gene ID - Rat ENSRNOG00000049388
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRR32 pAb (ATL-HPA048386)
Datasheet Anti PRR32 pAb (ATL-HPA048386) Datasheet (External Link)
Vendor Page Anti PRR32 pAb (ATL-HPA048386) at Atlas Antibodies

Documents & Links for Anti PRR32 pAb (ATL-HPA048386)
Datasheet Anti PRR32 pAb (ATL-HPA048386) Datasheet (External Link)
Vendor Page Anti PRR32 pAb (ATL-HPA048386)