Anti PRR3 pAb (ATL-HPA064061)

Atlas Antibodies

Catalog No.:
ATL-HPA064061-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: proline rich 3
Gene Name: PRR3
Alternative Gene Name: CAT56, Em:AB014077.1, Em:AB023052.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038500: 86%, ENSRNOG00000025806: 83%
Entrez Gene ID: 80742
Uniprot ID: P79522
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSLPPPPWGRGPIRRGLGPRSSPYGRGWWGVNAEPPFPGPGHGGPTRGSFHKEQRNPRRLKSWSLIKNTCPPKDDPQVMEDKSDRPVCRH
Gene Sequence LSLPPPPWGRGPIRRGLGPRSSPYGRGWWGVNAEPPFPGPGHGGPTRGSFHKEQRNPRRLKSWSLIKNTCPPKDDPQVMEDKSDRPVCRH
Gene ID - Mouse ENSMUSG00000038500
Gene ID - Rat ENSRNOG00000025806
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRR3 pAb (ATL-HPA064061)
Datasheet Anti PRR3 pAb (ATL-HPA064061) Datasheet (External Link)
Vendor Page Anti PRR3 pAb (ATL-HPA064061) at Atlas Antibodies

Documents & Links for Anti PRR3 pAb (ATL-HPA064061)
Datasheet Anti PRR3 pAb (ATL-HPA064061) Datasheet (External Link)
Vendor Page Anti PRR3 pAb (ATL-HPA064061)