Anti PRR26 pAb (ATL-HPA066037)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066037-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PRR26
Alternative Gene Name: C10orf108, FLJ38681
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024818: 34%, ENSRNOG00000010588: 33%
Entrez Gene ID:
Uniprot ID: Q8N8Z3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SPTPPKLSPGQLSPHSVNVHWGPQGHLHLPRSGTTVLHAYLQTLSSPAS |
| Gene Sequence | SPTPPKLSPGQLSPHSVNVHWGPQGHLHLPRSGTTVLHAYLQTLSSPAS |
| Gene ID - Mouse | ENSMUSG00000024818 |
| Gene ID - Rat | ENSRNOG00000010588 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRR26 pAb (ATL-HPA066037) | |
| Datasheet | Anti PRR26 pAb (ATL-HPA066037) Datasheet (External Link) |
| Vendor Page | Anti PRR26 pAb (ATL-HPA066037) at Atlas Antibodies |
| Documents & Links for Anti PRR26 pAb (ATL-HPA066037) | |
| Datasheet | Anti PRR26 pAb (ATL-HPA066037) Datasheet (External Link) |
| Vendor Page | Anti PRR26 pAb (ATL-HPA066037) |