Anti PRR20A pAb (ATL-HPA059485)

Atlas Antibodies

Catalog No.:
ATL-HPA059485-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: proline rich 20A
Gene Name: PRR20A
Alternative Gene Name: FLJ40296, PRR20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029636: 36%, ENSRNOG00000026675: 35%
Entrez Gene ID: 122183
Uniprot ID: P86496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQP
Gene Sequence MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQP
Gene ID - Mouse ENSMUSG00000029636
Gene ID - Rat ENSRNOG00000026675
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRR20A pAb (ATL-HPA059485)
Datasheet Anti PRR20A pAb (ATL-HPA059485) Datasheet (External Link)
Vendor Page Anti PRR20A pAb (ATL-HPA059485) at Atlas Antibodies

Documents & Links for Anti PRR20A pAb (ATL-HPA059485)
Datasheet Anti PRR20A pAb (ATL-HPA059485) Datasheet (External Link)
Vendor Page Anti PRR20A pAb (ATL-HPA059485)