Anti PRR19 pAb (ATL-HPA070350)

Atlas Antibodies

Catalog No.:
ATL-HPA070350-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: proline rich 19
Gene Name: PRR19
Alternative Gene Name: MGC70924
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058741: 57%, ENSRNOG00000043154: 62%
Entrez Gene ID: 284338
Uniprot ID: A6NJB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DARDAIVHTLQACHGCVPDLALVLRGCQPPLPGAKPGVSERKMTPFWINSPDQVPEQER
Gene Sequence DARDAIVHTLQACHGCVPDLALVLRGCQPPLPGAKPGVSERKMTPFWINSPDQVPEQER
Gene ID - Mouse ENSMUSG00000058741
Gene ID - Rat ENSRNOG00000043154
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRR19 pAb (ATL-HPA070350)
Datasheet Anti PRR19 pAb (ATL-HPA070350) Datasheet (External Link)
Vendor Page Anti PRR19 pAb (ATL-HPA070350) at Atlas Antibodies

Documents & Links for Anti PRR19 pAb (ATL-HPA070350)
Datasheet Anti PRR19 pAb (ATL-HPA070350) Datasheet (External Link)
Vendor Page Anti PRR19 pAb (ATL-HPA070350)