Anti PRR18 pAb (ATL-HPA077250 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA077250-25
  • Immunohistochemistry analysis in human cerebral cortex and lymph node tissues using Anti-PRR18 antibody. Corresponding PRR18 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: proline rich 18
Gene Name: PRR18
Alternative Gene Name: MGC35308
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055945: 75%, ENSRNOG00000024149: 73%
Entrez Gene ID: 285800
Uniprot ID: Q8N4B5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CPDSAARFSLNLTPEAVLVIQKRHLEKQLLARPRRPFPSPSAEPRRLLAPCLPAR
Gene Sequence CPDSAARFSLNLTPEAVLVIQKRHLEKQLLARPRRPFPSPSAEPRRLLAPCLPAR
Gene ID - Mouse ENSMUSG00000055945
Gene ID - Rat ENSRNOG00000024149
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PRR18 pAb (ATL-HPA077250 w/enhanced validation)
Datasheet Anti PRR18 pAb (ATL-HPA077250 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRR18 pAb (ATL-HPA077250 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PRR18 pAb (ATL-HPA077250 w/enhanced validation)
Datasheet Anti PRR18 pAb (ATL-HPA077250 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRR18 pAb (ATL-HPA077250 w/enhanced validation)