Anti PRR14L pAb (ATL-HPA062645)

Atlas Antibodies

Catalog No.:
ATL-HPA062645-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: proline rich 14-like
Gene Name: PRR14L
Alternative Gene Name: C22orf30, MGC50372
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054280: 58%, ENSRNOG00000048891: 53%
Entrez Gene ID: 253143
Uniprot ID: Q5THK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASTVDFLKIKKSCEENVCRSLKDCEMEKCPDSCAHEMESVADHEPNKRILGRVNLSLNDSHYGQQDKGTSLRETQEMTEGSRLEPNSEFGKEST
Gene Sequence ASTVDFLKIKKSCEENVCRSLKDCEMEKCPDSCAHEMESVADHEPNKRILGRVNLSLNDSHYGQQDKGTSLRETQEMTEGSRLEPNSEFGKEST
Gene ID - Mouse ENSMUSG00000054280
Gene ID - Rat ENSRNOG00000048891
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRR14L pAb (ATL-HPA062645)
Datasheet Anti PRR14L pAb (ATL-HPA062645) Datasheet (External Link)
Vendor Page Anti PRR14L pAb (ATL-HPA062645) at Atlas Antibodies

Documents & Links for Anti PRR14L pAb (ATL-HPA062645)
Datasheet Anti PRR14L pAb (ATL-HPA062645) Datasheet (External Link)
Vendor Page Anti PRR14L pAb (ATL-HPA062645)