Anti PRR14 pAb (ATL-HPA060265)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060265-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PRR14
Alternative Gene Name: MGC3121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030822: 49%, ENSRNOG00000018518: 49%
Entrez Gene ID: 78994
Uniprot ID: Q9BWN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IHRTSSTLRRRSRTTPGPEEGPSQKVDRAPQPTLVVMLEDIASPRPPAEGFIDETPNFIIPAQRAEPMRIVRQPTPPPGDLEPPFQPSALPADPLESPPTAPDP |
| Gene Sequence | IHRTSSTLRRRSRTTPGPEEGPSQKVDRAPQPTLVVMLEDIASPRPPAEGFIDETPNFIIPAQRAEPMRIVRQPTPPPGDLEPPFQPSALPADPLESPPTAPDP |
| Gene ID - Mouse | ENSMUSG00000030822 |
| Gene ID - Rat | ENSRNOG00000018518 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRR14 pAb (ATL-HPA060265) | |
| Datasheet | Anti PRR14 pAb (ATL-HPA060265) Datasheet (External Link) |
| Vendor Page | Anti PRR14 pAb (ATL-HPA060265) at Atlas Antibodies |
| Documents & Links for Anti PRR14 pAb (ATL-HPA060265) | |
| Datasheet | Anti PRR14 pAb (ATL-HPA060265) Datasheet (External Link) |
| Vendor Page | Anti PRR14 pAb (ATL-HPA060265) |
| Citations for Anti PRR14 pAb (ATL-HPA060265) – 1 Found |
| Li, Fangfang; Zhang, Chundong; Fu, Lijuan. PRR14 overexpression promotes cell growth, epithelial to mesenchymal transition and metastasis of colon cancer via the AKT pathway. Plos One. 14(10):e0218839. PubMed |