Anti PRR13 pAb (ATL-HPA046219)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046219-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: PRR13
Alternative Gene Name: DKFZP564J157, FLJ23818
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023048: 73%, ENSRNOG00000042094: 70%
Entrez Gene ID: 54458
Uniprot ID: Q9NZ81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKK |
Gene Sequence | PYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKK |
Gene ID - Mouse | ENSMUSG00000023048 |
Gene ID - Rat | ENSRNOG00000042094 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRR13 pAb (ATL-HPA046219) | |
Datasheet | Anti PRR13 pAb (ATL-HPA046219) Datasheet (External Link) |
Vendor Page | Anti PRR13 pAb (ATL-HPA046219) at Atlas Antibodies |
Documents & Links for Anti PRR13 pAb (ATL-HPA046219) | |
Datasheet | Anti PRR13 pAb (ATL-HPA046219) Datasheet (External Link) |
Vendor Page | Anti PRR13 pAb (ATL-HPA046219) |
Citations for Anti PRR13 pAb (ATL-HPA046219) – 1 Found |
Duan, Shuquan; Yin, Jie; Bai, Zhigang; Zhang, Zhongtao. Effects of taxol resistance gene 1 on the cisplatin response in gastric cancer. Oncology Letters. 2018;15(6):8287-8294. PubMed |