Anti PRR13 pAb (ATL-HPA046219)

Atlas Antibodies

Catalog No.:
ATL-HPA046219-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: proline rich 13
Gene Name: PRR13
Alternative Gene Name: DKFZP564J157, FLJ23818
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023048: 73%, ENSRNOG00000042094: 70%
Entrez Gene ID: 54458
Uniprot ID: Q9NZ81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKK
Gene Sequence PYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKK
Gene ID - Mouse ENSMUSG00000023048
Gene ID - Rat ENSRNOG00000042094
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRR13 pAb (ATL-HPA046219)
Datasheet Anti PRR13 pAb (ATL-HPA046219) Datasheet (External Link)
Vendor Page Anti PRR13 pAb (ATL-HPA046219) at Atlas Antibodies

Documents & Links for Anti PRR13 pAb (ATL-HPA046219)
Datasheet Anti PRR13 pAb (ATL-HPA046219) Datasheet (External Link)
Vendor Page Anti PRR13 pAb (ATL-HPA046219)
Citations for Anti PRR13 pAb (ATL-HPA046219) – 1 Found
Duan, Shuquan; Yin, Jie; Bai, Zhigang; Zhang, Zhongtao. Effects of taxol resistance gene 1 on the cisplatin response in gastric cancer. Oncology Letters. 2018;15(6):8287-8294.  PubMed