Anti PRR13 pAb (ATL-HPA039396)

Atlas Antibodies

Catalog No.: ATL-HPA039396-25

Protein Description: proline rich 13
Gene Name: PRR13
Alternative Gene Name: DKFZP564J157, FLJ23818
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023048: 73%, ENSRNOG00000042094: 70%
Entrez Gene ID: 54458
Uniprot ID: Q9NZ81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKK
• Gene Sequence: PYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKK
• Gene ID - Mouse: ENSMUSG00000023048
• Gene ID - Rat: ENSRNOG00000042094
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.