Anti PRR13 pAb (ATL-HPA039396)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039396-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PRR13
Alternative Gene Name: DKFZP564J157, FLJ23818
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023048: 73%, ENSRNOG00000042094: 70%
Entrez Gene ID: 54458
Uniprot ID: Q9NZ81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKK |
| Gene Sequence | PYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKK |
| Gene ID - Mouse | ENSMUSG00000023048 |
| Gene ID - Rat | ENSRNOG00000042094 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRR13 pAb (ATL-HPA039396) | |
| Datasheet | Anti PRR13 pAb (ATL-HPA039396) Datasheet (External Link) |
| Vendor Page | Anti PRR13 pAb (ATL-HPA039396) at Atlas Antibodies |
| Documents & Links for Anti PRR13 pAb (ATL-HPA039396) | |
| Datasheet | Anti PRR13 pAb (ATL-HPA039396) Datasheet (External Link) |
| Vendor Page | Anti PRR13 pAb (ATL-HPA039396) |