Anti PRPSAP2 pAb (ATL-HPA021881)

Atlas Antibodies

Catalog No.: ATL-HPA021881-100

Protein Description: phosphoribosyl pyrophosphate synthetase-associated protein 2
Gene Name: PRPSAP2
Alternative Gene Name: PAP41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020528: 98%, ENSRNOG00000002724: 98%
Entrez Gene ID: 5636
Uniprot ID: O60256
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQES
• Gene Sequence: VTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQES
• Gene ID - Mouse: ENSMUSG00000020528
• Gene ID - Rat: ENSRNOG00000002724
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.