Anti PRPH pAb (ATL-HPA063887 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA063887-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: peripherin
Gene Name: PRPH
Alternative Gene Name: NEF4, PRPH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023484: 83%, ENSRNOG00000052880: 90%
Entrez Gene ID: 5630
Uniprot ID: P41219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTI
Gene Sequence EESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTI
Gene ID - Mouse ENSMUSG00000023484
Gene ID - Rat ENSRNOG00000052880
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRPH pAb (ATL-HPA063887 w/enhanced validation)
Datasheet Anti PRPH pAb (ATL-HPA063887 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRPH pAb (ATL-HPA063887 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PRPH pAb (ATL-HPA063887 w/enhanced validation)
Datasheet Anti PRPH pAb (ATL-HPA063887 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRPH pAb (ATL-HPA063887 w/enhanced validation)