Anti PRPF38B pAb (ATL-HPA053255)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053255-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: PRPF38B
Alternative Gene Name: FLJ10330, NET1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027881: 98%, ENSRNOG00000020438: 99%
Entrez Gene ID: 55119
Uniprot ID: Q5VTL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QQQQCDGGGATKPAVSGKQGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGG |
| Gene Sequence | QQQQCDGGGATKPAVSGKQGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGG |
| Gene ID - Mouse | ENSMUSG00000027881 |
| Gene ID - Rat | ENSRNOG00000020438 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRPF38B pAb (ATL-HPA053255) | |
| Datasheet | Anti PRPF38B pAb (ATL-HPA053255) Datasheet (External Link) |
| Vendor Page | Anti PRPF38B pAb (ATL-HPA053255) at Atlas Antibodies |
| Documents & Links for Anti PRPF38B pAb (ATL-HPA053255) | |
| Datasheet | Anti PRPF38B pAb (ATL-HPA053255) Datasheet (External Link) |
| Vendor Page | Anti PRPF38B pAb (ATL-HPA053255) |