Anti PRPF38B pAb (ATL-HPA053255)

Atlas Antibodies

Catalog No.: ATL-HPA053255-100

Protein Description: pre-mRNA processing factor 38B
Gene Name: PRPF38B
Alternative Gene Name: FLJ10330, NET1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027881: 98%, ENSRNOG00000020438: 99%
Entrez Gene ID: 55119
Uniprot ID: Q5VTL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQQQCDGGGATKPAVSGKQGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGG
• Gene Sequence: QQQQCDGGGATKPAVSGKQGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGG
• Gene ID - Mouse: ENSMUSG00000027881
• Gene ID - Rat: ENSRNOG00000020438
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.