Anti PRPF31 pAb (ATL-HPA061873)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061873-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PRPF31
Alternative Gene Name: hPrp31, NY-BR-99, PRP31, RP11, SNRNP61
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008373: 97%, ENSRNOG00000061039: 99%
Entrez Gene ID: 26121
Uniprot ID: Q8WWY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGN |
| Gene Sequence | SGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGN |
| Gene ID - Mouse | ENSMUSG00000008373 |
| Gene ID - Rat | ENSRNOG00000061039 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRPF31 pAb (ATL-HPA061873) | |
| Datasheet | Anti PRPF31 pAb (ATL-HPA061873) Datasheet (External Link) |
| Vendor Page | Anti PRPF31 pAb (ATL-HPA061873) at Atlas Antibodies |
| Documents & Links for Anti PRPF31 pAb (ATL-HPA061873) | |
| Datasheet | Anti PRPF31 pAb (ATL-HPA061873) Datasheet (External Link) |
| Vendor Page | Anti PRPF31 pAb (ATL-HPA061873) |