Anti PRPF31 pAb (ATL-HPA061873)

Atlas Antibodies

SKU: ATL-HPA061873-25

• 

Protein Description: pre-mRNA processing factor 31
Gene Name: PRPF31
Alternative Gene Name: hPrp31, NY-BR-99, PRP31, RP11, SNRNP61
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008373: 97%, ENSRNOG00000061039: 99%
Entrez Gene ID: 26121
Uniprot ID: Q8WWY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGN
• Gene Sequence: SGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGN
• Gene ID - Mouse: ENSMUSG00000008373
• Gene ID - Rat: ENSRNOG00000061039
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.