Anti PRPF31 pAb (ATL-HPA061873)

Atlas Antibodies

Catalog No.:
ATL-HPA061873-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: pre-mRNA processing factor 31
Gene Name: PRPF31
Alternative Gene Name: hPrp31, NY-BR-99, PRP31, RP11, SNRNP61
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008373: 97%, ENSRNOG00000061039: 99%
Entrez Gene ID: 26121
Uniprot ID: Q8WWY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGN
Gene Sequence SGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGN
Gene ID - Mouse ENSMUSG00000008373
Gene ID - Rat ENSRNOG00000061039
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRPF31 pAb (ATL-HPA061873)
Datasheet Anti PRPF31 pAb (ATL-HPA061873) Datasheet (External Link)
Vendor Page Anti PRPF31 pAb (ATL-HPA061873) at Atlas Antibodies

Documents & Links for Anti PRPF31 pAb (ATL-HPA061873)
Datasheet Anti PRPF31 pAb (ATL-HPA061873) Datasheet (External Link)
Vendor Page Anti PRPF31 pAb (ATL-HPA061873)