Anti PROSER3 pAb (ATL-HPA058492)

Atlas Antibodies

SKU: ATL-HPA058492-25

• 
• 

Protein Description: proline and serine rich 3
Gene Name: PROSER3
Alternative Gene Name: C19orf55, FLJ30657
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036864: 72%, ENSRNOG00000024625: 61%
Entrez Gene ID: 148137
Uniprot ID: Q2NL68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTAVNVTSASHAVAPLQEIKQNLHTWNSSLLDLETLSLQSRAARLLKRSKASIS
• Gene Sequence: PTAVNVTSASHAVAPLQEIKQNLHTWNSSLLDLETLSLQSRAARLLKRSKASIS
• Gene ID - Mouse: ENSMUSG00000036864
• Gene ID - Rat: ENSRNOG00000024625
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.