Anti PROSER3 pAb (ATL-HPA058492)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058492-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PROSER3
Alternative Gene Name: C19orf55, FLJ30657
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036864: 72%, ENSRNOG00000024625: 61%
Entrez Gene ID: 148137
Uniprot ID: Q2NL68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTAVNVTSASHAVAPLQEIKQNLHTWNSSLLDLETLSLQSRAARLLKRSKASIS |
| Gene Sequence | PTAVNVTSASHAVAPLQEIKQNLHTWNSSLLDLETLSLQSRAARLLKRSKASIS |
| Gene ID - Mouse | ENSMUSG00000036864 |
| Gene ID - Rat | ENSRNOG00000024625 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PROSER3 pAb (ATL-HPA058492) | |
| Datasheet | Anti PROSER3 pAb (ATL-HPA058492) Datasheet (External Link) |
| Vendor Page | Anti PROSER3 pAb (ATL-HPA058492) at Atlas Antibodies |
| Documents & Links for Anti PROSER3 pAb (ATL-HPA058492) | |
| Datasheet | Anti PROSER3 pAb (ATL-HPA058492) Datasheet (External Link) |
| Vendor Page | Anti PROSER3 pAb (ATL-HPA058492) |