Anti PROSER1 pAb (ATL-HPA055687)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055687-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PROSER1
Alternative Gene Name: bA50D16.2, C13orf23, FLJ12661
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049504: 90%, ENSRNOG00000010980: 90%
Entrez Gene ID: 80209
Uniprot ID: Q86XN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSKDKLVALELLASNIIDAQNSRPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAM |
| Gene Sequence | EQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSKDKLVALELLASNIIDAQNSRPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAM |
| Gene ID - Mouse | ENSMUSG00000049504 |
| Gene ID - Rat | ENSRNOG00000010980 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PROSER1 pAb (ATL-HPA055687) | |
| Datasheet | Anti PROSER1 pAb (ATL-HPA055687) Datasheet (External Link) |
| Vendor Page | Anti PROSER1 pAb (ATL-HPA055687) at Atlas Antibodies |
| Documents & Links for Anti PROSER1 pAb (ATL-HPA055687) | |
| Datasheet | Anti PROSER1 pAb (ATL-HPA055687) Datasheet (External Link) |
| Vendor Page | Anti PROSER1 pAb (ATL-HPA055687) |