Anti PROSER1 pAb (ATL-HPA055687)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055687-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PROSER1
Alternative Gene Name: bA50D16.2, C13orf23, FLJ12661
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049504: 90%, ENSRNOG00000010980: 90%
Entrez Gene ID: 80209
Uniprot ID: Q86XN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSKDKLVALELLASNIIDAQNSRPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAM |
Gene Sequence | EQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSKDKLVALELLASNIIDAQNSRPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAM |
Gene ID - Mouse | ENSMUSG00000049504 |
Gene ID - Rat | ENSRNOG00000010980 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PROSER1 pAb (ATL-HPA055687) | |
Datasheet | Anti PROSER1 pAb (ATL-HPA055687) Datasheet (External Link) |
Vendor Page | Anti PROSER1 pAb (ATL-HPA055687) at Atlas Antibodies |
Documents & Links for Anti PROSER1 pAb (ATL-HPA055687) | |
Datasheet | Anti PROSER1 pAb (ATL-HPA055687) Datasheet (External Link) |
Vendor Page | Anti PROSER1 pAb (ATL-HPA055687) |