Anti PROM1 pAb (ATL-HPA004922 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA004922-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: PROM1
Alternative Gene Name: AC133, CD133, MCDR2, PROML1, RP41, STGD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029086: 57%, ENSRNOG00000003098: 60%
Entrez Gene ID: 8842
Uniprot ID: O43490
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLS |
Gene Sequence | QYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLS |
Gene ID - Mouse | ENSMUSG00000029086 |
Gene ID - Rat | ENSRNOG00000003098 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PROM1 pAb (ATL-HPA004922 w/enhanced validation) | |
Datasheet | Anti PROM1 pAb (ATL-HPA004922 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PROM1 pAb (ATL-HPA004922 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PROM1 pAb (ATL-HPA004922 w/enhanced validation) | |
Datasheet | Anti PROM1 pAb (ATL-HPA004922 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PROM1 pAb (ATL-HPA004922 w/enhanced validation) |
Citations for Anti PROM1 pAb (ATL-HPA004922 w/enhanced validation) – 2 Found |
Liu, Zhaojian; Gersbach, Elizabeth; Zhang, Xiyu; Xu, Xiaofei; Dong, Ruifen; Lee, Peng; Liu, Jinsong; Kong, Beihua; Shao, Changshun; Wei, Jian-Jun. miR-106a represses the Rb tumor suppressor p130 to regulate cellular proliferation and differentiation in high-grade serous ovarian carcinoma. Molecular Cancer Research : Mcr. 2013;11(11):1314-25. PubMed |
Corell, Alba; Gómez Vecchio, Tomás; Ferreyra Vega, Sandra; Dénes, Anna; Neimantaite, Alice; Hagerius, Alexander; Barchéus, Hanna; Solheim, Ole; Lindskog, Cecilia; Bontell, Thomas Olsson; Carén, Helena; Jakola, Asgeir S; Smits, Anja. Stemness and clinical features in relation to the subventricular zone in diffuse lower-grade glioma: an exploratory study. Neuro-Oncology Advances. 2022;4(1):vdac074. PubMed |