Anti PROCA1 pAb (ATL-HPA023648)

Atlas Antibodies

Catalog No.: ATL-HPA023648-25

Protein Description: protein interacting with cyclin A1
Gene Name: PROCA1
Alternative Gene Name: MGC39650
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044122: 35%, ENSRNOG00000023381: 37%
Entrez Gene ID: 147011
Uniprot ID: Q8NCQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTLTIERWTKEKTEPKARSWDESRCRGDCKEPDKCCWRHKQCTGHIIYPFASDCVRHSLHLHSVNHCNCNS
• Gene Sequence: TTLTIERWTKEKTEPKARSWDESRCRGDCKEPDKCCWRHKQCTGHIIYPFASDCVRHSLHLHSVNHCNCNS
• Gene ID - Mouse: ENSMUSG00000044122
• Gene ID - Rat: ENSRNOG00000023381
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.