Anti PROCA1 pAb (ATL-HPA023648)

Atlas Antibodies

Catalog No.:
ATL-HPA023648-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein interacting with cyclin A1
Gene Name: PROCA1
Alternative Gene Name: MGC39650
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044122: 35%, ENSRNOG00000023381: 37%
Entrez Gene ID: 147011
Uniprot ID: Q8NCQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTLTIERWTKEKTEPKARSWDESRCRGDCKEPDKCCWRHKQCTGHIIYPFASDCVRHSLHLHSVNHCNCNS
Gene Sequence TTLTIERWTKEKTEPKARSWDESRCRGDCKEPDKCCWRHKQCTGHIIYPFASDCVRHSLHLHSVNHCNCNS
Gene ID - Mouse ENSMUSG00000044122
Gene ID - Rat ENSRNOG00000023381
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PROCA1 pAb (ATL-HPA023648)
Datasheet Anti PROCA1 pAb (ATL-HPA023648) Datasheet (External Link)
Vendor Page Anti PROCA1 pAb (ATL-HPA023648) at Atlas Antibodies

Documents & Links for Anti PROCA1 pAb (ATL-HPA023648)
Datasheet Anti PROCA1 pAb (ATL-HPA023648) Datasheet (External Link)
Vendor Page Anti PROCA1 pAb (ATL-HPA023648)