Anti PROB1 pAb (ATL-HPA060103 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA060103-25

Protein Description: proline-rich basic protein 1
Gene Name: PROB1
Alternative Gene Name: C5orf65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073600: 79%, ENSRNOG00000039596: 82%
Entrez Gene ID: 389333
Uniprot ID: E7EW31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VKTTYAPGFPAGAQGSGLPAPPADPCGEEGGESKTQEPPALGPPAPAHYTSVFIKDFLPVVPHPYEPPEPS
• Gene Sequence: VKTTYAPGFPAGAQGSGLPAPPADPCGEEGGESKTQEPPALGPPAPAHYTSVFIKDFLPVVPHPYEPPEPS
• Gene ID - Mouse: ENSMUSG00000073600
• Gene ID - Rat: ENSRNOG00000039596
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.