Anti PROB1 pAb (ATL-HPA060103 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060103-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PROB1
Alternative Gene Name: C5orf65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073600: 79%, ENSRNOG00000039596: 82%
Entrez Gene ID: 389333
Uniprot ID: E7EW31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VKTTYAPGFPAGAQGSGLPAPPADPCGEEGGESKTQEPPALGPPAPAHYTSVFIKDFLPVVPHPYEPPEPS |
Gene Sequence | VKTTYAPGFPAGAQGSGLPAPPADPCGEEGGESKTQEPPALGPPAPAHYTSVFIKDFLPVVPHPYEPPEPS |
Gene ID - Mouse | ENSMUSG00000073600 |
Gene ID - Rat | ENSRNOG00000039596 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PROB1 pAb (ATL-HPA060103 w/enhanced validation) | |
Datasheet | Anti PROB1 pAb (ATL-HPA060103 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PROB1 pAb (ATL-HPA060103 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PROB1 pAb (ATL-HPA060103 w/enhanced validation) | |
Datasheet | Anti PROB1 pAb (ATL-HPA060103 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PROB1 pAb (ATL-HPA060103 w/enhanced validation) |