Anti PRNT pAb (ATL-HPA045000)

Atlas Antibodies

Catalog No.:
ATL-HPA045000-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: prion protein (testis specific)
Gene Name: PRNT
Alternative Gene Name: M8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056724: 27%, ENSRNOG00000009738: 28%
Entrez Gene ID:
Uniprot ID: Q86SH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDASIHPFRLPFSSKPFLLIPMSNTTLPHTAWPLSFLHQTVSTLKAVAVTHSLWHLQIPVDCQACNR
Gene Sequence LDASIHPFRLPFSSKPFLLIPMSNTTLPHTAWPLSFLHQTVSTLKAVAVTHSLWHLQIPVDCQACNR
Gene ID - Mouse ENSMUSG00000056724
Gene ID - Rat ENSRNOG00000009738
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRNT pAb (ATL-HPA045000)
Datasheet Anti PRNT pAb (ATL-HPA045000) Datasheet (External Link)
Vendor Page Anti PRNT pAb (ATL-HPA045000) at Atlas Antibodies

Documents & Links for Anti PRNT pAb (ATL-HPA045000)
Datasheet Anti PRNT pAb (ATL-HPA045000) Datasheet (External Link)
Vendor Page Anti PRNT pAb (ATL-HPA045000)