Anti PRMT6 pAb (ATL-HPA059424)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059424-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PRMT6
Alternative Gene Name: FLJ10559, HRMT1L6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049300: 91%, ENSRNOG00000048996: 95%
Entrez Gene ID: 55170
Uniprot ID: Q96LA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAME |
Gene Sequence | WKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAME |
Gene ID - Mouse | ENSMUSG00000049300 |
Gene ID - Rat | ENSRNOG00000048996 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRMT6 pAb (ATL-HPA059424) | |
Datasheet | Anti PRMT6 pAb (ATL-HPA059424) Datasheet (External Link) |
Vendor Page | Anti PRMT6 pAb (ATL-HPA059424) at Atlas Antibodies |
Documents & Links for Anti PRMT6 pAb (ATL-HPA059424) | |
Datasheet | Anti PRMT6 pAb (ATL-HPA059424) Datasheet (External Link) |
Vendor Page | Anti PRMT6 pAb (ATL-HPA059424) |