Anti PRMT2 pAb (ATL-HPA029591)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029591-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: PRMT2
Alternative Gene Name: HRMT1L1, MGC111373
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020230: 89%, ENSRNOG00000001297: 91%
Entrez Gene ID: 3275
Uniprot ID: P55345
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLD |
| Gene Sequence | RDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLD |
| Gene ID - Mouse | ENSMUSG00000020230 |
| Gene ID - Rat | ENSRNOG00000001297 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRMT2 pAb (ATL-HPA029591) | |
| Datasheet | Anti PRMT2 pAb (ATL-HPA029591) Datasheet (External Link) |
| Vendor Page | Anti PRMT2 pAb (ATL-HPA029591) at Atlas Antibodies |
| Documents & Links for Anti PRMT2 pAb (ATL-HPA029591) | |
| Datasheet | Anti PRMT2 pAb (ATL-HPA029591) Datasheet (External Link) |
| Vendor Page | Anti PRMT2 pAb (ATL-HPA029591) |