Anti PRMT2 pAb (ATL-HPA018976)

Atlas Antibodies

Catalog No.: ATL-HPA018976-100

Protein Description: protein arginine methyltransferase 2
Gene Name: PRMT2
Alternative Gene Name: HRMT1L1, MGC111373
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020230: 93%, ENSRNOG00000001297: 94%
Entrez Gene ID: 3275
Uniprot ID: P55345
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSW
• Gene Sequence: LRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSW
• Gene ID - Mouse: ENSMUSG00000020230
• Gene ID - Rat: ENSRNOG00000001297
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRMT2 pAb (ATL-HPA018976) – 1 Found

Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094.