Anti PRMT1 pAb (ATL-HPA072136)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072136-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: PRMT1
Alternative Gene Name: ANM1, HCP1, HRMT1L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109324: 100%, ENSRNOG00000004090: 62%
Entrez Gene ID: 3276
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYY |
| Gene Sequence | VATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYY |
| Gene ID - Mouse | ENSMUSG00000109324 |
| Gene ID - Rat | ENSRNOG00000004090 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRMT1 pAb (ATL-HPA072136) | |
| Datasheet | Anti PRMT1 pAb (ATL-HPA072136) Datasheet (External Link) |
| Vendor Page | Anti PRMT1 pAb (ATL-HPA072136) at Atlas Antibodies |
| Documents & Links for Anti PRMT1 pAb (ATL-HPA072136) | |
| Datasheet | Anti PRMT1 pAb (ATL-HPA072136) Datasheet (External Link) |
| Vendor Page | Anti PRMT1 pAb (ATL-HPA072136) |