Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056386-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PRM2
Alternative Gene Name: CT94.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038015: 51%, ENSRNOG00000002539: 51%
Entrez Gene ID: 5620
Uniprot ID: P04554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQS |
| Gene Sequence | MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQS |
| Gene ID - Mouse | ENSMUSG00000038015 |
| Gene ID - Rat | ENSRNOG00000002539 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation) | |
| Datasheet | Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation) | |
| Datasheet | Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation) |
| Citations for Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation) – 2 Found |
| Yao, Chencheng; Yuan, Qingqing; Niu, Minghui; Fu, Hongyong; Zhou, Fan; Zhang, Wenhui; Wang, Hong; Wen, Liping; Wu, Ligang; Li, Zheng; He, Zuping. Distinct Expression Profiles and Novel Targets of MicroRNAs in Human Spermatogonia, Pachytene Spermatocytes, and Round Spermatids between OA Patients and NOA Patients. Molecular Therapy. Nucleic Acids. 2017;9( 29246297):182-194. PubMed |
| Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88. PubMed |