Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA056386-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: protamine 2
Gene Name: PRM2
Alternative Gene Name: CT94.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038015: 51%, ENSRNOG00000002539: 51%
Entrez Gene ID: 5620
Uniprot ID: P04554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQS
Gene Sequence MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQS
Gene ID - Mouse ENSMUSG00000038015
Gene ID - Rat ENSRNOG00000002539
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation)
Datasheet Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation)
Datasheet Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation)
Citations for Anti PRM2 pAb (ATL-HPA056386 w/enhanced validation) – 2 Found
Yao, Chencheng; Yuan, Qingqing; Niu, Minghui; Fu, Hongyong; Zhou, Fan; Zhang, Wenhui; Wang, Hong; Wen, Liping; Wu, Ligang; Li, Zheng; He, Zuping. Distinct Expression Profiles and Novel Targets of MicroRNAs in Human Spermatogonia, Pachytene Spermatocytes, and Round Spermatids between OA Patients and NOA Patients. Molecular Therapy. Nucleic Acids. 2017;9( 29246297):182-194.  PubMed
Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88.  PubMed