Anti PRLH pAb (ATL-HPA014976)

Atlas Antibodies

Catalog No.:
ATL-HPA014976-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: prolactin releasing hormone
Gene Name: PRLH
Alternative Gene Name: PRH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090550: 73%, ENSRNOG00000019871: 65%
Entrez Gene ID: 51052
Uniprot ID: P81277
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRPRLTCFPLEGGAMSSQD
Gene Sequence RTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRPRLTCFPLEGGAMSSQD
Gene ID - Mouse ENSMUSG00000090550
Gene ID - Rat ENSRNOG00000019871
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRLH pAb (ATL-HPA014976)
Datasheet Anti PRLH pAb (ATL-HPA014976) Datasheet (External Link)
Vendor Page Anti PRLH pAb (ATL-HPA014976) at Atlas Antibodies

Documents & Links for Anti PRLH pAb (ATL-HPA014976)
Datasheet Anti PRLH pAb (ATL-HPA014976) Datasheet (External Link)
Vendor Page Anti PRLH pAb (ATL-HPA014976)