Anti PRL pAb (ATL-HPA062017 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA062017-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: prolactin
Gene Name: PRL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021342: 60%, ENSRNOG00000017374: 56%
Entrez Gene ID: 5617
Uniprot ID: P01236
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRG
Gene Sequence PLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRG
Gene ID - Mouse ENSMUSG00000021342
Gene ID - Rat ENSRNOG00000017374
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRL pAb (ATL-HPA062017 w/enhanced validation)
Datasheet Anti PRL pAb (ATL-HPA062017 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRL pAb (ATL-HPA062017 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PRL pAb (ATL-HPA062017 w/enhanced validation)
Datasheet Anti PRL pAb (ATL-HPA062017 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRL pAb (ATL-HPA062017 w/enhanced validation)