Anti PRKD3 pAb (ATL-HPA029529)

Atlas Antibodies

Catalog No.: ATL-HPA029529-25

Protein Description: protein kinase D3
Gene Name: PRKD3
Alternative Gene Name: EPK2, PRKCN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024070: 94%, ENSRNOG00000005289: 92%
Entrez Gene ID: 23683
Uniprot ID: O94806
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGM
• Gene Sequence: ANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGM
• Gene ID - Mouse: ENSMUSG00000024070
• Gene ID - Rat: ENSRNOG00000005289
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.