Anti PRKCSH pAb (ATL-HPA041940 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041940-25

Protein Description: protein kinase C substrate 80K-H
Gene Name: PRKCSH
Alternative Gene Name: G19P1, PCLD, PLD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003402: 89%, ENSRNOG00000013360: 91%
Entrez Gene ID: 5589
Uniprot ID: P14314
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPAEEDKMPPYDEQTQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQCYELTTNEYVYRLCPFKLVSQKPK
• Gene Sequence: SPAEEDKMPPYDEQTQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQCYELTTNEYVYRLCPFKLVSQKPK
• Gene ID - Mouse: ENSMUSG00000003402
• Gene ID - Rat: ENSRNOG00000013360
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.