Anti PRKCQ pAb (ATL-HPA065279)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065279-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PRKCQ
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026778: 96%, ENSRNOG00000019057: 96%
Entrez Gene ID: 5588
Uniprot ID: Q04759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQK |
| Gene Sequence | SPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQK |
| Gene ID - Mouse | ENSMUSG00000026778 |
| Gene ID - Rat | ENSRNOG00000019057 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRKCQ pAb (ATL-HPA065279) | |
| Datasheet | Anti PRKCQ pAb (ATL-HPA065279) Datasheet (External Link) |
| Vendor Page | Anti PRKCQ pAb (ATL-HPA065279) at Atlas Antibodies |
| Documents & Links for Anti PRKCQ pAb (ATL-HPA065279) | |
| Datasheet | Anti PRKCQ pAb (ATL-HPA065279) Datasheet (External Link) |
| Vendor Page | Anti PRKCQ pAb (ATL-HPA065279) |