Anti PRKCQ pAb (ATL-HPA065279)

Atlas Antibodies

Catalog No.:
ATL-HPA065279-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: protein kinase C, theta
Gene Name: PRKCQ
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026778: 96%, ENSRNOG00000019057: 96%
Entrez Gene ID: 5588
Uniprot ID: Q04759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQK
Gene Sequence SPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQK
Gene ID - Mouse ENSMUSG00000026778
Gene ID - Rat ENSRNOG00000019057
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRKCQ pAb (ATL-HPA065279)
Datasheet Anti PRKCQ pAb (ATL-HPA065279) Datasheet (External Link)
Vendor Page Anti PRKCQ pAb (ATL-HPA065279) at Atlas Antibodies

Documents & Links for Anti PRKCQ pAb (ATL-HPA065279)
Datasheet Anti PRKCQ pAb (ATL-HPA065279) Datasheet (External Link)
Vendor Page Anti PRKCQ pAb (ATL-HPA065279)