Anti PRKCI pAb (ATL-HPA026574)

Atlas Antibodies

Catalog No.: ATL-HPA026574-25

Protein Description: protein kinase C, iota
Gene Name: PRKCI
Alternative Gene Name: DXS1179E, PKCI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037643: 93%, ENSRNOG00000009652: 95%
Entrez Gene ID: 5584
Uniprot ID: P41743
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: INCKLLVHKKCHKLVTIECGRHSLPQEPVMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRV
• Gene Sequence: INCKLLVHKKCHKLVTIECGRHSLPQEPVMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRV
• Gene ID - Mouse: ENSMUSG00000037643
• Gene ID - Rat: ENSRNOG00000009652
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRKCI pAb (ATL-HPA026574) – 1 Found

Sarkar, Sharmistha; Bristow, Christopher A; Dey, Prasenjit; Rai, Kunal; Perets, Ruth; Ramirez-Cardenas, Alejandra; Malasi, Shruti; Huang-Hobbs, Emmet; Haemmerle, Monika; Wu, Sherry Y; McGuire, Michael; Protopopov, Alexei; Jiang, Shan; Liu, Joyce F; Hirsch, Michelle S; Chang, Qing; Lazar, Alexander J; Sood, Anil K; Drapkin, Ronny; DePinho, Ronald; Draetta, Giulio; Chin, Lynda. PRKCI promotes immune suppression in ovarian cancer. Genes & Development. 2017;31(11):1109-1121.