Anti PRKCH pAb (ATL-HPA026294)

Atlas Antibodies

Catalog No.:
ATL-HPA026294-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: protein kinase C, eta
Gene Name: PRKCH
Alternative Gene Name: PKC-L, PKCL, PRKCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021108: 98%, ENSRNOG00000004873: 97%
Entrez Gene ID: 5583
Uniprot ID: P24723
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNF
Gene Sequence FKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNF
Gene ID - Mouse ENSMUSG00000021108
Gene ID - Rat ENSRNOG00000004873
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRKCH pAb (ATL-HPA026294)
Datasheet Anti PRKCH pAb (ATL-HPA026294) Datasheet (External Link)
Vendor Page Anti PRKCH pAb (ATL-HPA026294) at Atlas Antibodies

Documents & Links for Anti PRKCH pAb (ATL-HPA026294)
Datasheet Anti PRKCH pAb (ATL-HPA026294) Datasheet (External Link)
Vendor Page Anti PRKCH pAb (ATL-HPA026294)