Anti PRKCE pAb (ATL-HPA054252)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054252-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PRKCE
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045038: 89%, ENSRNOG00000015603: 92%
Entrez Gene ID: 5581
Uniprot ID: Q02156
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKR |
Gene Sequence | PSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKR |
Gene ID - Mouse | ENSMUSG00000045038 |
Gene ID - Rat | ENSRNOG00000015603 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRKCE pAb (ATL-HPA054252) | |
Datasheet | Anti PRKCE pAb (ATL-HPA054252) Datasheet (External Link) |
Vendor Page | Anti PRKCE pAb (ATL-HPA054252) at Atlas Antibodies |
Documents & Links for Anti PRKCE pAb (ATL-HPA054252) | |
Datasheet | Anti PRKCE pAb (ATL-HPA054252) Datasheet (External Link) |
Vendor Page | Anti PRKCE pAb (ATL-HPA054252) |