Anti PRKCE pAb (ATL-HPA054252)

Atlas Antibodies

Catalog No.:
ATL-HPA054252-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: protein kinase C, epsilon
Gene Name: PRKCE
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045038: 89%, ENSRNOG00000015603: 92%
Entrez Gene ID: 5581
Uniprot ID: Q02156
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKR
Gene Sequence PSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKR
Gene ID - Mouse ENSMUSG00000045038
Gene ID - Rat ENSRNOG00000015603
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRKCE pAb (ATL-HPA054252)
Datasheet Anti PRKCE pAb (ATL-HPA054252) Datasheet (External Link)
Vendor Page Anti PRKCE pAb (ATL-HPA054252) at Atlas Antibodies

Documents & Links for Anti PRKCE pAb (ATL-HPA054252)
Datasheet Anti PRKCE pAb (ATL-HPA054252) Datasheet (External Link)
Vendor Page Anti PRKCE pAb (ATL-HPA054252)