Anti PRKCD pAb (ATL-HPA001890 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA001890-25
  • Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using HPA001890 antibody. Corresponding PRKCD RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and PRKCD over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403724).
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: protein kinase C, delta
Gene Name: PRKCD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021948: 79%, ENSRNOG00000016346: 80%
Entrez Gene ID: 5580
Uniprot ID: Q05655
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDH
Gene Sequence ANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDH
Gene ID - Mouse ENSMUSG00000021948
Gene ID - Rat ENSRNOG00000016346
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PRKCD pAb (ATL-HPA001890 w/enhanced validation)
Datasheet Anti PRKCD pAb (ATL-HPA001890 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRKCD pAb (ATL-HPA001890 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PRKCD pAb (ATL-HPA001890 w/enhanced validation)
Datasheet Anti PRKCD pAb (ATL-HPA001890 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRKCD pAb (ATL-HPA001890 w/enhanced validation)