Anti PRKCB pAb (ATL-HPA054203)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054203-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: PRKCB
Alternative Gene Name: PKCB, PRKCB1, PRKCB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052889: 90%, ENSRNOG00000012061: 90%
Entrez Gene ID: 5579
Uniprot ID: P05771
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTD |
| Gene Sequence | RQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTD |
| Gene ID - Mouse | ENSMUSG00000052889 |
| Gene ID - Rat | ENSRNOG00000012061 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRKCB pAb (ATL-HPA054203) | |
| Datasheet | Anti PRKCB pAb (ATL-HPA054203) Datasheet (External Link) |
| Vendor Page | Anti PRKCB pAb (ATL-HPA054203) at Atlas Antibodies |
| Documents & Links for Anti PRKCB pAb (ATL-HPA054203) | |
| Datasheet | Anti PRKCB pAb (ATL-HPA054203) Datasheet (External Link) |
| Vendor Page | Anti PRKCB pAb (ATL-HPA054203) |