Anti PRKCB pAb (ATL-HPA054203)

Atlas Antibodies

Catalog No.:
ATL-HPA054203-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: protein kinase C, beta
Gene Name: PRKCB
Alternative Gene Name: PKCB, PRKCB1, PRKCB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052889: 90%, ENSRNOG00000012061: 90%
Entrez Gene ID: 5579
Uniprot ID: P05771
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTD
Gene Sequence RQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTD
Gene ID - Mouse ENSMUSG00000052889
Gene ID - Rat ENSRNOG00000012061
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRKCB pAb (ATL-HPA054203)
Datasheet Anti PRKCB pAb (ATL-HPA054203) Datasheet (External Link)
Vendor Page Anti PRKCB pAb (ATL-HPA054203) at Atlas Antibodies

Documents & Links for Anti PRKCB pAb (ATL-HPA054203)
Datasheet Anti PRKCB pAb (ATL-HPA054203) Datasheet (External Link)
Vendor Page Anti PRKCB pAb (ATL-HPA054203)