Anti PRKCB pAb (ATL-HPA048321)

Atlas Antibodies

SKU: ATL-HPA048321-25

• 
• 

Protein Description: protein kinase C, beta
Gene Name: PRKCB
Alternative Gene Name: PKCB, PRKCB1, PRKCB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052889: 100%, ENSRNOG00000012061: 100%
Entrez Gene ID: 5579
Uniprot ID: P05771
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVIN
• Gene Sequence: EKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVIN
• Gene ID - Mouse: ENSMUSG00000052889
• Gene ID - Rat: ENSRNOG00000012061
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.