Anti PRKAR2B pAb (ATL-HPA063879)

Atlas Antibodies

Catalog No.: ATL-HPA063879-25

Protein Description: protein kinase cAMP-dependent type II regulatory subunit beta
Gene Name: PRKAR2B
Alternative Gene Name: PRKAR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002997: 98%, ENSRNOG00000009079: 95%
Entrez Gene ID: 5577
Uniprot ID: P31323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEI
• Gene Sequence: LKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEI
• Gene ID - Mouse: ENSMUSG00000002997
• Gene ID - Rat: ENSRNOG00000009079
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.