Anti PRKAR2B pAb (ATL-HPA063879)

Atlas Antibodies

Catalog No.:
ATL-HPA063879-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: protein kinase cAMP-dependent type II regulatory subunit beta
Gene Name: PRKAR2B
Alternative Gene Name: PRKAR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002997: 98%, ENSRNOG00000009079: 95%
Entrez Gene ID: 5577
Uniprot ID: P31323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEI
Gene Sequence LKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEI
Gene ID - Mouse ENSMUSG00000002997
Gene ID - Rat ENSRNOG00000009079
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRKAR2B pAb (ATL-HPA063879)
Datasheet Anti PRKAR2B pAb (ATL-HPA063879) Datasheet (External Link)
Vendor Page Anti PRKAR2B pAb (ATL-HPA063879) at Atlas Antibodies

Documents & Links for Anti PRKAR2B pAb (ATL-HPA063879)
Datasheet Anti PRKAR2B pAb (ATL-HPA063879) Datasheet (External Link)
Vendor Page Anti PRKAR2B pAb (ATL-HPA063879)