Anti PRKAR1B pAb (ATL-HPA026719 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026719-25

Protein Description: protein kinase, cAMP-dependent, regulatory, type I, beta
Gene Name: PRKAR1B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025855: 86%, ENSRNOG00000049876: 60%
Entrez Gene ID: 5575
Uniprot ID: P31321
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSNSQSDSHDEEVSPT
• Gene Sequence: QQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSNSQSDSHDEEVSPT
• Gene ID - Mouse: ENSMUSG00000025855
• Gene ID - Rat: ENSRNOG00000049876
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.