Anti PRKAR1A pAb (ATL-HPA049979)

Atlas Antibodies

Catalog No.:
ATL-HPA049979-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: protein kinase, cAMP-dependent, regulatory, type I, alpha
Gene Name: PRKAR1A
Alternative Gene Name: CNC1, PRKAR1, TSE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020612: 90%, ENSRNOG00000049876: 90%
Entrez Gene ID: 5573
Uniprot ID: P10644
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPP
Gene Sequence MAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPP
Gene ID - Mouse ENSMUSG00000020612
Gene ID - Rat ENSRNOG00000049876
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRKAR1A pAb (ATL-HPA049979)
Datasheet Anti PRKAR1A pAb (ATL-HPA049979) Datasheet (External Link)
Vendor Page Anti PRKAR1A pAb (ATL-HPA049979) at Atlas Antibodies

Documents & Links for Anti PRKAR1A pAb (ATL-HPA049979)
Datasheet Anti PRKAR1A pAb (ATL-HPA049979) Datasheet (External Link)
Vendor Page Anti PRKAR1A pAb (ATL-HPA049979)
Citations for Anti PRKAR1A pAb (ATL-HPA049979) – 1 Found
Ito, Shin; Hashimoto, Aya; Yamaguchi, Kazunori; Kawamura, Sadafumi; Myoen, Shingo; Ogawa, Maki; Sato, Ikuro; Minato, Takamichi; Miyabe, Shingo; Nakazato, Akira; Fujii, Keitaro; Mochizuki, Mai; Fujimori, Haruna; Tamai, Keiichi; Niihori, Tetsuya; Aoki, Yoko; Sugawara, Akira; Sasano, Hironobu; Shima, Hiroshi; Yasuda, Jun. A novel 8.57-kb deletion of the upstream region of PRKAR1A in a family with Carney complex. Molecular Genetics & Genomic Medicine. 2022;10(3):e1884.  PubMed