Anti PRKAG1 pAb (ATL-HPA077805)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077805-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PRKAG1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067713: 67%, ENSRNOG00000061499: 60%
Entrez Gene ID: 5571
Uniprot ID: P54619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | METVISSDSSPAVENEHPQETPESNNSVYT |
| Gene Sequence | METVISSDSSPAVENEHPQETPESNNSVYT |
| Gene ID - Mouse | ENSMUSG00000067713 |
| Gene ID - Rat | ENSRNOG00000061499 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRKAG1 pAb (ATL-HPA077805) | |
| Datasheet | Anti PRKAG1 pAb (ATL-HPA077805) Datasheet (External Link) |
| Vendor Page | Anti PRKAG1 pAb (ATL-HPA077805) at Atlas Antibodies |
| Documents & Links for Anti PRKAG1 pAb (ATL-HPA077805) | |
| Datasheet | Anti PRKAG1 pAb (ATL-HPA077805) Datasheet (External Link) |
| Vendor Page | Anti PRKAG1 pAb (ATL-HPA077805) |