Anti PRKAG1 pAb (ATL-HPA077805)

Atlas Antibodies

SKU: ATL-HPA077805-25

• 

Protein Description: protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Gene Name: PRKAG1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067713: 67%, ENSRNOG00000061499: 60%
Entrez Gene ID: 5571
Uniprot ID: P54619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: METVISSDSSPAVENEHPQETPESNNSVYT
• Gene Sequence: METVISSDSSPAVENEHPQETPESNNSVYT
• Gene ID - Mouse: ENSMUSG00000067713
• Gene ID - Rat: ENSRNOG00000061499
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.