Anti PRKACB pAb (ATL-HPA029754)

Atlas Antibodies

Catalog No.: ATL-HPA029754-25

Protein Description: protein kinase, cAMP-dependent, catalytic, beta
Gene Name: PRKACB
Alternative Gene Name: PKACb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005034: 73%, ENSRNOG00000004978: 29%
Entrez Gene ID: 5567
Uniprot ID: P22694
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAAYREPPCNQYTGTTTALQKLEGFASRLFHRHSKGTAHDQKTALENDSLHFSEHTALWDRSMKEFLAKAKEDFLKKWENPTQNNAGLEDFER
• Gene Sequence: MAAYREPPCNQYTGTTTALQKLEGFASRLFHRHSKGTAHDQKTALENDSLHFSEHTALWDRSMKEFLAKAKEDFLKKWENPTQNNAGLEDFER
• Gene ID - Mouse: ENSMUSG00000005034
• Gene ID - Rat: ENSRNOG00000004978
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRKACB pAb (ATL-HPA029754) – 1 Found

Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.