Anti PRKACA pAb (ATL-HPA071185)

Atlas Antibodies

Catalog No.:
ATL-HPA071185-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: protein kinase, cAMP-dependent, catalytic, alpha
Gene Name: PRKACA
Alternative Gene Name: PKACa
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005469: 98%, ENSRNOG00000005257: 100%
Entrez Gene ID: 5566
Uniprot ID: P17612
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVP
Gene Sequence KQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVP
Gene ID - Mouse ENSMUSG00000005469
Gene ID - Rat ENSRNOG00000005257
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRKACA pAb (ATL-HPA071185)
Datasheet Anti PRKACA pAb (ATL-HPA071185) Datasheet (External Link)
Vendor Page Anti PRKACA pAb (ATL-HPA071185) at Atlas Antibodies

Documents & Links for Anti PRKACA pAb (ATL-HPA071185)
Datasheet Anti PRKACA pAb (ATL-HPA071185) Datasheet (External Link)
Vendor Page Anti PRKACA pAb (ATL-HPA071185)