Anti PRKACA pAb (ATL-HPA071185)

Atlas Antibodies

Catalog No.: ATL-HPA071185-100

Protein Description: protein kinase, cAMP-dependent, catalytic, alpha
Gene Name: PRKACA
Alternative Gene Name: PKACa
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005469: 98%, ENSRNOG00000005257: 100%
Entrez Gene ID: 5566
Uniprot ID: P17612
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVP
• Gene Sequence: KQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVP
• Gene ID - Mouse: ENSMUSG00000005469
• Gene ID - Rat: ENSRNOG00000005257
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.