Anti PRKACA pAb (ATL-HPA071185)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071185-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: PRKACA
Alternative Gene Name: PKACa
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005469: 98%, ENSRNOG00000005257: 100%
Entrez Gene ID: 5566
Uniprot ID: P17612
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVP |
| Gene Sequence | KQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVP |
| Gene ID - Mouse | ENSMUSG00000005469 |
| Gene ID - Rat | ENSRNOG00000005257 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRKACA pAb (ATL-HPA071185) | |
| Datasheet | Anti PRKACA pAb (ATL-HPA071185) Datasheet (External Link) |
| Vendor Page | Anti PRKACA pAb (ATL-HPA071185) at Atlas Antibodies |
| Documents & Links for Anti PRKACA pAb (ATL-HPA071185) | |
| Datasheet | Anti PRKACA pAb (ATL-HPA071185) Datasheet (External Link) |
| Vendor Page | Anti PRKACA pAb (ATL-HPA071185) |