Anti PRKAA1 pAb (ATL-HPA064946)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064946-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: PRKAA1
Alternative Gene Name: AMPKa1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050697: 100%, ENSRNOG00000012799: 100%
Entrez Gene ID: 5562
Uniprot ID: Q13131
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA |
Gene Sequence | NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA |
Gene ID - Mouse | ENSMUSG00000050697 |
Gene ID - Rat | ENSRNOG00000012799 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRKAA1 pAb (ATL-HPA064946) | |
Datasheet | Anti PRKAA1 pAb (ATL-HPA064946) Datasheet (External Link) |
Vendor Page | Anti PRKAA1 pAb (ATL-HPA064946) at Atlas Antibodies |
Documents & Links for Anti PRKAA1 pAb (ATL-HPA064946) | |
Datasheet | Anti PRKAA1 pAb (ATL-HPA064946) Datasheet (External Link) |
Vendor Page | Anti PRKAA1 pAb (ATL-HPA064946) |