Anti PRIMA1 pAb (ATL-HPA046671)

Atlas Antibodies

Catalog No.:
ATL-HPA046671-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: proline rich membrane anchor 1
Gene Name: PRIMA1
Alternative Gene Name: PRIMA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041669: 91%, ENSRNOG00000008915: 89%
Entrez Gene ID: 145270
Uniprot ID: Q86XR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRKPLRKDENGTSVAEYPMSASQSNKGVDVNNAVV
Gene Sequence KRKPLRKDENGTSVAEYPMSASQSNKGVDVNNAVV
Gene ID - Mouse ENSMUSG00000041669
Gene ID - Rat ENSRNOG00000008915
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRIMA1 pAb (ATL-HPA046671)
Datasheet Anti PRIMA1 pAb (ATL-HPA046671) Datasheet (External Link)
Vendor Page Anti PRIMA1 pAb (ATL-HPA046671) at Atlas Antibodies

Documents & Links for Anti PRIMA1 pAb (ATL-HPA046671)
Datasheet Anti PRIMA1 pAb (ATL-HPA046671) Datasheet (External Link)
Vendor Page Anti PRIMA1 pAb (ATL-HPA046671)