Anti PRIMA1 pAb (ATL-HPA046671)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046671-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PRIMA1
Alternative Gene Name: PRIMA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041669: 91%, ENSRNOG00000008915: 89%
Entrez Gene ID: 145270
Uniprot ID: Q86XR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KRKPLRKDENGTSVAEYPMSASQSNKGVDVNNAVV |
Gene Sequence | KRKPLRKDENGTSVAEYPMSASQSNKGVDVNNAVV |
Gene ID - Mouse | ENSMUSG00000041669 |
Gene ID - Rat | ENSRNOG00000008915 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRIMA1 pAb (ATL-HPA046671) | |
Datasheet | Anti PRIMA1 pAb (ATL-HPA046671) Datasheet (External Link) |
Vendor Page | Anti PRIMA1 pAb (ATL-HPA046671) at Atlas Antibodies |
Documents & Links for Anti PRIMA1 pAb (ATL-HPA046671) | |
Datasheet | Anti PRIMA1 pAb (ATL-HPA046671) Datasheet (External Link) |
Vendor Page | Anti PRIMA1 pAb (ATL-HPA046671) |