Anti PRIMA1 pAb (ATL-HPA046671)

Atlas Antibodies

Catalog No.: ATL-HPA046671-25

Protein Description: proline rich membrane anchor 1
Gene Name: PRIMA1
Alternative Gene Name: PRIMA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041669: 91%, ENSRNOG00000008915: 89%
Entrez Gene ID: 145270
Uniprot ID: Q86XR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRKPLRKDENGTSVAEYPMSASQSNKGVDVNNAVV
• Gene Sequence: KRKPLRKDENGTSVAEYPMSASQSNKGVDVNNAVV
• Gene ID - Mouse: ENSMUSG00000041669
• Gene ID - Rat: ENSRNOG00000008915
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.