Anti PRICKLE3 pAb (ATL-HPA000998)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000998-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PRICKLE3
Alternative Gene Name: LMO6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031145: 79%, ENSRNOG00000022417: 75%
Entrez Gene ID: 4007
Uniprot ID: O43900
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LIFCSRACSLGSEPTAPGPSRRSWSAGPVTAPLAASTASFSAVKGASETTTKGTSTELAPATGPEEPSRFLRGAPHRHSMPELGLRSVPEPPPESPGQPNLRPDDSAFGRQS |
| Gene Sequence | LIFCSRACSLGSEPTAPGPSRRSWSAGPVTAPLAASTASFSAVKGASETTTKGTSTELAPATGPEEPSRFLRGAPHRHSMPELGLRSVPEPPPESPGQPNLRPDDSAFGRQS |
| Gene ID - Mouse | ENSMUSG00000031145 |
| Gene ID - Rat | ENSRNOG00000022417 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRICKLE3 pAb (ATL-HPA000998) | |
| Datasheet | Anti PRICKLE3 pAb (ATL-HPA000998) Datasheet (External Link) |
| Vendor Page | Anti PRICKLE3 pAb (ATL-HPA000998) at Atlas Antibodies |
| Documents & Links for Anti PRICKLE3 pAb (ATL-HPA000998) | |
| Datasheet | Anti PRICKLE3 pAb (ATL-HPA000998) Datasheet (External Link) |
| Vendor Page | Anti PRICKLE3 pAb (ATL-HPA000998) |
| Citations for Anti PRICKLE3 pAb (ATL-HPA000998) – 1 Found |
| Jakobsen, Lis; Vanselow, Katja; Skogs, Marie; Toyoda, Yusuke; Lundberg, Emma; Poser, Ina; Falkenby, Lasse G; Bennetzen, Martin; Westendorf, Jens; Nigg, Erich A; Uhlen, Mathias; Hyman, Anthony A; Andersen, Jens S. Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods. The Embo Journal. 2011;30(8):1520-35. PubMed |