Anti PRG3 pAb (ATL-HPA064183 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA064183-25
  • Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-PRG3 antibody. Corresponding PRG3 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: proteoglycan 3
Gene Name: PRG3
Alternative Gene Name: MBPH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027072: 57%, ENSRNOG00000037908: 51%
Entrez Gene ID: 10394
Uniprot ID: Q9Y2Y8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHLENDAPHLESLETQADLGQDLDSSKEQERDLALTEEVIQAEGEEVKASACQDNFEDEEAMESDPAALDKDFQ
Gene Sequence LHLENDAPHLESLETQADLGQDLDSSKEQERDLALTEEVIQAEGEEVKASACQDNFEDEEAMESDPAALDKDFQ
Gene ID - Mouse ENSMUSG00000027072
Gene ID - Rat ENSRNOG00000037908
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PRG3 pAb (ATL-HPA064183 w/enhanced validation)
Datasheet Anti PRG3 pAb (ATL-HPA064183 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRG3 pAb (ATL-HPA064183 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PRG3 pAb (ATL-HPA064183 w/enhanced validation)
Datasheet Anti PRG3 pAb (ATL-HPA064183 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRG3 pAb (ATL-HPA064183 w/enhanced validation)