Anti PRG2 pAb (ATL-HPA038515 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038515-25

Protein Description: proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein)
Gene Name: PRG2
Alternative Gene Name: BMPG, MBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027073: 51%, ENSRNOG00000008394: 50%
Entrez Gene ID: 5553
Uniprot ID: P13727
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRC
• Gene Sequence: GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRC
• Gene ID - Mouse: ENSMUSG00000027073
• Gene ID - Rat: ENSRNOG00000008394
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRG2 pAb (ATL-HPA038515 w/enhanced validation) – 2 Found

Seebauer, Caroline Theresa; Brunner, Stefan; Glockzin, Gabriel; Piso, Pompiliu; Ruemmele, Petra; Schlitt, Hans-Juergen; Geissler, Edward Kenneth; Fichtner-Feigl, Stefan; Kesselring, Rebecca. Peritoneal carcinomatosis of colorectal cancer is characterized by structural and functional reorganization of the tumor microenvironment inducing senescence and proliferation arrest in cancer cells. Oncoimmunology. 5(12):e1242543. 

Zhang, Elisa T; Hannibal, Roberta L; Badillo Rivera, Keyla M; Song, Janet H T; McGowan, Kelly; Zhu, Xiaowei; Meinhardt, Gudrun; Knöfler, Martin; Pollheimer, Jürgen; Urban, Alexander E; Folkins, Ann K; Lyell, Deirdre J; Baker, Julie C. PRG2 and AQPEP are misexpressed in fetal membranes in placenta previa and percreta†. Biology Of Reproduction. 2021;105(1):244-257.